PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2DS_9430AAD52.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 750aa    MW: 81803.9 Da    PI: 4.9131
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2DS_9430AAD52.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding35.42.5e-115292748
                           HHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  7 eEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           eEd+ l   ++ +G+++W+ Ia  +   +t+ qc+ rw++yl
  Traes_2DS_9430AAD52.1 52 EEDDVLRAQIAHHGTDNWTVIATQFK-DKTARQCRRRWYNYL 92
                           9************************9.**************7 PP

2Myb_DNA-binding41.14e-1398141146
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                            +g W+ eEd ll +a k+lG++ W+ Ia+ +  gRt++ +k+r+ +
  Traes_2DS_9430AAD52.1  98 KGGWSREEDMLLCEAQKLLGNK-WTEIAKVVS-GRTDNAVKNRFST 141
                            688*******************.*********.**********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.8094592IPR017930Myb domain
SMARTSM007171.4E-74594IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-175199IPR009057Homeodomain-like
PfamPF139213.3E-1352109No hitNo description
CDDcd001672.70E-105292No hitNo description
SuperFamilySSF466891.76E-2471150IPR009057Homeodomain-like
PROSITE profilePS5129419.49993147IPR017930Myb domain
SMARTSM007171.3E-1397145IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.6E-19100146IPR009057Homeodomain-like
CDDcd001671.24E-9101142No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 750 aa     Download sequence    Send to blast
PALRPAGPVR GTCGIWAHGD RPRSDLLLRR RRRRRVVGGQ EGPPHRQLER REEDDVLRAQ  60
IAHHGTDNWT VIATQFKDKT ARQCRRRWYN YLNTECKKGG WSREEDMLLC EAQKLLGNKW  120
TEIAKVVSGR TDNAVKNRFS TLCKRRAKDD ELFEENGTVC SNASAKRVLT RSGGVTCAAP  180
GSSPPIKNMS SCKPDFKENL APNMKSFGQQ KSIQQDSRQP LASICPDNQS VNIVKTQSLV  240
TKTSTKQLHG EEQSCVKHEG NFLKRNDPKL ATLLQQADLL SSLATKVNTE NTSQSMDEAW  300
QKLQNHLVKK DDNDMSESSM SGTASLLDDL DDLIVDPYEN EEEDEQKSRE QNGATSQMAP  360
DQIMDNCPVD QIADESSLCG NTLSSTMEPC PVAEILAHIN LGEAAEDMGL HFMEYSSPTH  420
AAQAQQAKAD AEIPASVDLS ESAEVQAQQA KADAEIPVSV DLSEAAEGSW SQFMEYTSPA  480
HTVLHAEGDA ETPASVKLSE AAEGSLPQCM EHMSPAHTLL RAKTDSEIPA SANSNEAAEG  540
SWSQFMEYMS PAHIVLHAKA DAETPASINL GEAAEGSLPQ CMEPMSPAHT LLRAKTDYEI  600
PASANLSEAA KDDSLQCTEY TSPARADLQA NADAEISENF SEVAQDSRLQ CAKFTSPAHT  660
AIKGKAVAKK GTSENCSDVP EDSSTQPCME FTSPAHTVPT FHPFTDNVPT PKITASERNF  720
LLSVLELASP GSKPETSQQP SCKRALLNSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-275114612107B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12834RRRRRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519130.0JF951913.1 Triticum carthlicum clone TaMYB30 R2R3-MYB protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010235205.10.0PREDICTED: uncharacterized protein LOC100835080 isoform X1
TrEMBLW5C6X70.0W5C6X7_WHEAT; Uncharacterized protein
STRINGMLOC_9840.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP89033847
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02820.14e-65myb domain protein 88
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]